PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_010894-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 271aa    MW: 31198.8 Da    PI: 4.725
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_010894-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.8e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+++++q+G g+W++ ++  g+ R++k+c++rw +yl
    NNU_010894-RA 14 KGPWTPEEDRILINYIQQYGHGNWRALPKQAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding56.75.5e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE+e +++++++lG++ W+tIa++++ gRt++++k+ w+++l
    NNU_010894-RA  67 RGNFSKEEEETIIELHEKLGNR-WSTIAARLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-27564IPR009057Homeodomain-like
PROSITE profilePS5129417.984961IPR017930Myb domain
SuperFamilySSF466897.05E-3210108IPR009057Homeodomain-like
SMARTSM007171.6E-151363IPR001005SANT/Myb domain
PfamPF002491.0E-161461IPR001005SANT/Myb domain
CDDcd001675.84E-121661No hitNo description
PROSITE profilePS5129426.73862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2765117IPR009057Homeodomain-like
SMARTSM007171.4E-1566114IPR001005SANT/Myb domain
PfamPF002493.0E-1667112IPR001005SANT/Myb domain
CDDcd001672.96E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MVRAPCCEKM GLKKGPWTPE EDRILINYIQ QYGHGNWRAL PKQAGLLRCG KSCRLRWTNY  60
LRPDIKRGNF SKEEEETIIE LHEKLGNRWS TIAARLPGRT DNEIKNVWHT HLKKRLKQYQ  120
PALNTKRQST EISEFDTCKL EESYLVNFPT NPRFESPTCP PVSPQQSSSD ISSVTESSVV  180
TGENQNTGIK EENVDSCSWE TIPEIDESFW FEALSADNSG TSDDYPATIT DQQLQFPSEP  240
VYAYGWNMDD GMDFWYNLFI KAGELPELPE F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKRLKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262320.10.0PREDICTED: myb-related protein Myb4
SwissprotQ7XBH41e-81MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A068TV821e-114A0A068TV82_COFCA; Uncharacterized protein
TrEMBLA0A061ELW61e-113A0A061ELW6_THECC; Myb domain protein 13, putative
STRINGPOPTR_0002s03960.11e-111(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.14e-72myb domain protein 15